PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400010920
Common NameLOC102596618
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 423aa    MW: 46542.4 Da    PI: 7.0265
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400010920genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.28e-29145202260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK v+g+ef+rsYY+Ct  +C +kk+vers+ d+++++i+Y  +H+h+k
  PGSC0003DMP400010920 145 KDGYNWRKYGQKLVRGNEFTRSYYKCTRINCLAKKQVERSQ-DGHITNIHYIAKHEHPK 202
                           7****************************************.***************85 PP

2WRKY101.83.9e-32323381159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ++Dgy+WrKYGqK vkg+++prsYYrC+s gCp+kk+vers+++pk v++ Yeg+H+h+
  PGSC0003DMP400010920 323 VNDGYRWRKYGQKFVKGNPNPRSYYRCSSVGCPAKKHVERSSHNPKSVITAYEGQHDHD 381
                           58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-25139203IPR003657WRKY domain
PROSITE profilePS5081121.769139203IPR003657WRKY domain
SuperFamilySSF1182908.89E-23142203IPR003657WRKY domain
SMARTSM007744.6E-29144202IPR003657WRKY domain
PfamPF031061.5E-21145201IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.0E-34311383IPR003657WRKY domain
SuperFamilySSF1182901.57E-28315383IPR003657WRKY domain
PROSITE profilePS5081135.301318383IPR003657WRKY domain
SMARTSM007746.0E-37323382IPR003657WRKY domain
PfamPF031062.5E-25324380IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MGVSKDDVSQ SNQEDSSLSN VPEKDTEYVH QKKGPESEGG ASESSRVSVL PKKEPYIISC  60
KSDSPVKDGN ISLVPGKASD SSQQIQSQKM EEVVSQPHQE QVTSSPMAEN ALCKLRSRRN  120
PDMSVQDLPS DKGVTPFSEP EKPSKDGYNW RKYGQKLVRG NEFTRSYYKC TRINCLAKKQ  180
VERSQDGHIT NIHYIAKHEH PKPLNSPQIS PELVVPSEMT QPDMPTETPR EAEGEKSTVL  240
GEACQSIEPS ESLISVAVVS AGGSAQDTVL KPHKSGDEGD NNDGRNSKRR KKEVPTSDDM  300
TPPMKSPSEL RHIVQTSSEV DIVNDGYRWR KYGQKFVKGN PNPRSYYRCS SVGCPAKKHV  360
ERSSHNPKSV ITAYEGQHDH DIPSSRTVMQ NTAEADSNTT RISGESTSES GENKHVVHIG  420
AN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-33311383274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006363023.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLM1A6I40.0M1A6I4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000157540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-68WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]